PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004515643.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 132aa    MW: 14533.6 Da    PI: 8.4706
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004515643.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.4e-4471061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk++rrkC+++Cv+apyfp ++p+kfa+vhk+FGasnv kll++++ ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l++l+ el+
  XP_004515643.2   7 PCAACKIQRRKCTEECVFAPYFPPDNPQKFAYVHKVFGASNVAKLLNEVNASQREDAVKSLAYEAEARLRDPVYGCVGLISLLQHNLKSLQIELN 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k+e
  XP_004515643.2 102 NAKKE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7856107IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-447104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MVPWNTPCAA CKIQRRKCTE ECVFAPYFPP DNPQKFAYVH KVFGASNVAK LLNEVNASQR  60
EDAVKSLAYE AEARLRDPVY GCVGLISLLQ HNLKSLQIEL NNAKKELASY WSSSYASSIT  120
TAAATTIFTA AA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515643.28e-95PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 6-like
SwissprotQ9FKZ39e-60LBD36_ARATH; LOB domain-containing protein 36
TrEMBLK7KUD85e-68K7KUD8_SOYBN; Uncharacterized protein
STRINGGLYMA06G11181.11e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-58ASYMMETRIC LEAVES 2-like 1